PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01055.1.g00260.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 298aa    MW: 32467.9 Da    PI: 10.6484
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01055.1.g00260.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.47.8e-28146195251
                                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   rienk+ rqvtf+kRrng+lKKA+ELS+LCdaeva+++fs+ g+ly +ss
  Zpz_sc01055.1.g00260.1.am.mk 146 RIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSS 195
                                   9***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.02137197IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-36137196IPR002100Transcription factor, MADS-box
CDDcd002658.23E-41138215No hitNo description
SuperFamilySSF554555.36E-30138219IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-29139159IPR002100Transcription factor, MADS-box
PROSITE patternPS003500139193IPR002100Transcription factor, MADS-box
PfamPF003191.5E-25146193IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-29159174IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-29174195IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MLCARVKQVS PCPVGAAAAA TTTTRPHVRT AAARARLPPA SVRERNRGRA RCLGRGDRPV  60
GCVGDGGRGR STKQSRAGAR ATAASYRVGW RCVKAGQATA AVAFGHKGAA PAARRHRPTD  120
RFGEGDRRRG EQDRSGMGRG KVVLQRIENK ISRQVTFAKR RNGLLKKAYE LSILCDAEVA  180
LVLFSHAGRL YQFSSSSNLF KTLERYQRYI YASADVAVPS SDEMQLTEVD AEAAPFPQLP  240
WRGAPDAMVS DGPPQPDHFF EALEGNPSLQ PAFQTMDINK VPVPEPGCCY YYPPAWRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-19137209172Myocyte-specific enhancer factor 2B
1tqe_R2e-19137209172Myocyte-specific enhancer factor 2B
1tqe_Q2e-19137209172Myocyte-specific enhancer factor 2B
1tqe_P2e-19137209172Myocyte-specific enhancer factor 2B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0424061e-112BT042406.1 Zea mays full-length cDNA clone ZM_BFb0221D10 mRNA, complete cds.
GenBankEU9617991e-112EU961799.1 Zea mays clone 238290 MADS-box transcription factor 34 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7474022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.11e-36MIKC_MADS family protein